PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10024687m
Common NameCARUB_v10024687mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family WRKY
Protein Properties Length: 391aa    MW: 43733.1 Da    PI: 6.945
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10024687mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY955.1e-30163220260
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                      +Dgy WrKYGqK+vk+se+prsY++Ct+++C +kk ve+++ d++++ei+Y+g Hnh+k
  Carubv10024687m 163 NDGYGWRKYGQKQVKKSENPRSYFKCTYPNCVSKKIVETAS-DGQITEIIYKGGHNHPK 220
                      8***************************************9.***************85 PP

2WRKY102.42.5e-32325382259
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       Dg++WrKYGqK+vkg+++prsYY+Ct++gC v+k+versa d+++v +tYeg+Hnh+
  Carubv10024687m 325 VDGFRWRKYGQKVVKGNTNPRSYYKCTYQGCGVRKQVERSAADERAVLTTYEGRHNHD 382
                      5********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.8E-25150221IPR003657WRKY domain
SuperFamilySSF1182904.58E-23159221IPR003657WRKY domain
SMARTSM007741.3E-30162220IPR003657WRKY domain
PfamPF031061.7E-22163219IPR003657WRKY domain
PROSITE profilePS5081120.461163221IPR003657WRKY domain
Gene3DG3DSA:2.20.25.808.1E-34309384IPR003657WRKY domain
SuperFamilySSF1182904.84E-28316384IPR003657WRKY domain
PROSITE profilePS5081134.119319384IPR003657WRKY domain
SMARTSM007745.3E-37324383IPR003657WRKY domain
PfamPF031062.9E-25326382IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0070370Biological Processcellular heat acclimation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MSSTSFTDLL ASSGVDCYED DEDLRVSGSS FGGYNPERTG SGLPKFKTAQ PPPLPISQSS  60
HNNFTFSDFL DSPLLLSSSH SLISPTTGAF PFQGSNNLSD FPWQLQPQPS NASSALQETY  120
GVQDHQKKQE LIPREVATQN NNQSFGSDRQ VKVPSYMVSR NSNDGYGWRK YGQKQVKKSE  180
NPRSYFKCTY PNCVSKKIVE TASDGQITEI IYKGGHNHPK PEFTKRPSQS SLPSSVNGRR  240
LFNPASVVSE PHDQSENSSI SFDYSDLEQK SFKSEYGEIE DDDEQPEIKR MKREGEDEGM  300
SIEVSRGVKE PRVVVQTISD IDVLVDGFRW RKYGQKVVKG NTNPRSYYKC TYQGCGVRKQ  360
VERSAADERA VLTTYEGRHN HDIPTALRRS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-32163384877Probable WRKY transcription factor 4
2lex_A2e-32163384877Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00282DAPTransfer from AT2G30250Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4183090.0AF418309.1 Arabidopsis thaliana WRKY transcription factor 25 (WRKY25) mRNA, complete cds.
GenBankAY0627200.0AY062720.1 Arabidopsis thaliana putative WRKY-type DNA binding protein (At2g30250; T9D9.6) mRNA, complete cds.
GenBankAY1146500.0AY114650.1 Arabidopsis thaliana putative WRKY-type DNA binding protein (At2g30250) mRNA, complete cds.
GenBankAY1363180.0AY136318.1 Arabidopsis thaliana putative WRKY-type DNA binding protein (At2g30250) mRNA, complete cds.
GenBankBT0084820.0BT008482.1 Arabidopsis thaliana At2g30250 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006295580.10.0hypothetical protein CARUB_v10024687mg
SwissprotO229210.0WRK25_ARATH; Probable WRKY transcription factor 25
TrEMBLR0HWQ30.0R0HWQ3_9BRAS; Uncharacterized protein
STRINGAT2G30250.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM116031733
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30250.10.0WRKY DNA-binding protein 25